PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g05320.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 524aa    MW: 58998 Da    PI: 6.2611
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g05320.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.54.5e-26287339356
         G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     +++WtpeLH++Fv+aveqL  +++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Vang11g05320.2 287 QVDWTPELHKKFVKAVEQL-SIDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 339
                     579****************.9*******************************96 PP

2Response_reg26.53.1e-10311451109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHT....TTSEEEEEESTTT.HHHHH CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireee....pklpiivvtahge.eedal 87 
                     vl+ +++ + +  +r  le  +y +v ++ d  eal  +  +   +++ ++ ++ +    G+++l++ +  +      +   vvt+++   +++ 
  Vang11g05320.2  31 VLLLEEDSISAAEIRAKLEAMDY-NVSTFCDENEALSAISSRPesFHIAIVEVSSSSsQGGFKFLENAKDLPtimiFPTS-HVVTSNNHcLNTMM 123
                     7899999999999**********.***************666666***********977999**9999999965432222.3556556569**** PP

                     HHHHTTESEEEESS--HHHHHH CS
    Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                     +++ +Ga +flsKp ++++l++
  Vang11g05320.2 124 KCIALGAVEFLSKPLSEDKLRN 145
                     *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23005.6E-1527182No hitNo description
SuperFamilySSF521721.85E-1427153IPR011006CheY-like superfamily
SMARTSM004480.008629147IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.92630151IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.1E-731146IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.14E-832150No hitNo description
Gene3DG3DSA:1.10.10.603.4E-25287342IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-23287339IPR006447Myb domain, plants
SuperFamilySSF466891.06E-16288342IPR009057Homeodomain-like
PfamPF002493.1E-6289337IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MPRLRNDAKP AMVFTANDLQ EWKDFPKGLK VLLLEEDSIS AAEIRAKLEA MDYNVSTFCD  60
ENEALSAISS RPESFHIAIV EVSSSSSQGG FKFLENAKDL PTIMIFPTSH VVTSNNHCLN  120
TMMKCIALGA VEFLSKPLSE DKLRNIWQHV VHKAFSSGTS ILCESLKPVK ESLVTMLQLP  180
TDNEQHESRV SIDIEKVSRF TDNDDVLSPG NDKYPAPSTP QLMHGTRLLD DGDCQEQTNC  240
STEKESGEHD GESKSVETTC DNIAETERNL GSSLSTELQF WYLFWSQVDW TPELHKKFVK  300
AVEQLSIDQA IPSRILELMK VEGLTRHNVA SHLQKYRMHR RQIFPKEEDR KWLNQRERSY  360
CVQRPIMAFP PYHSNHTHTM APIYPKWGQP STQTAGMHMW STPGYPLWQP TAEHWHWKPF  420
PGMHADAWGC PVLPVPPPQA PFPYSKNMPA LLNADATGHT FTMPQSSLEN YPAEEVVDKV  480
VKEAVSKPWL PLPLGLKPPS TDSVLTELSR QGICSIPPRS SKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-14287343763ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003550939.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-133APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0L9TPU60.0A0A0L9TPU6_PHAAN; Uncharacterized protein
STRINGGLYMA17G16360.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-124ARR-B family protein